PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009598333.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 199aa    MW: 22644.6 Da    PI: 10.1945
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009598333.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.45.2e-18106158254
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     rk+ ++tkeq  +Le+ F+++++++ ++++ LA++l+L  rqV vWFqNrRa+
  XP_009598333.1 106 RKKLRLTKEQSAVLEDSFKEHSTLNSKQKRNLATRLSLRPRQVEVWFQNRRAR 158
                     788899**********************************************8 PP

2HD-ZIP_I/II82.56.3e-27106164159
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkql 59 
                     +kk+rl+keq+++LE+sF+e+++L++++K +la++L l+prqv+vWFqnrRAR+ t+++
  XP_009598333.1 106 RKKLRLTKEQSAVLEDSFKEHSTLNSKQKRNLATRLSLRPRQVEVWFQNRRARITTRRI 164
                     69****************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-1794156IPR009057Homeodomain-like
PROSITE profilePS5007116.342102162IPR001356Homeobox domain
SuperFamilySSF466891.28E-16103159IPR009057Homeodomain-like
SMARTSM003891.2E-13104166IPR001356Homeobox domain
PfamPF000462.5E-15106158IPR001356Homeobox domain
CDDcd000863.05E-10106154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MICNTRLSLS LLGSSGESTT PKRKSNQDQE LDINPFPSLT LCLSSSAVNS SVISAAVSSF  60
SNSSIKRERD ASFEEEVELD TNKVIISPKL DDVDQEQDED HEFGTRKKLR LTKEQSAVLE  120
DSFKEHSTLN SKQKRNLATR LSLRPRQVEV WFQNRRARIT TRRISIWGRL TRPENQKSTT  180
SKKIGQLTLM DTKLFVPLF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104110TRKKLRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009598333.11e-142PREDICTED: homeobox-leucine zipper protein HAT22-like isoform X2
TrEMBLK4BUF99e-42K4BUF9_SOLLC; Uncharacterized protein
STRINGSolyc04g077220.2.13e-41(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-20homeobox from Arabidopsis thaliana